Inventors
Nancy Lewis
Assignees
- NOVARTIS AG (Basel, CH)
Abstract
Dosing regimens for the administration of complexes comprising IL-15/IL-15Ra in combination with an anti-PD-1 antibody molecule to patients are disclosed. Such dosing regiments can be used for preventing, treating and/or managing disorders such as cancer.
CovalX Technology Used
Outcomes
In order to determine the average mass of IL-15Rα, a mass spectrometer that had been modified with a CovalX HM1 detection system was used. Prior to analysis, the samples were mixed with a sinapic acid matrix. Through the use of MALDI-TOF mass spectrometry, researchers were able to compare the mass of a glycosylated form of IL-15Rα with that of the non-glycosylated form to determine the exact percent of the mass that glycosylation accounts for in IL-15Rα. They were also able to determine at what amino acid residues the N- or O-glycosylation occurred. The following glycosylation sites were found through epitope mapping:
- O-glycosylation on threonine at position 5 of the amino acid sequence NWELTASASHQPPGVYPQG
- O-glycosylation on serine at position 7 of the amino acid sequence NWELTASASHQPPGVYPQG
- N-glycosylation on serine at position 8 of the amino acid sequence ITCPPPMSVEHADIWVK or serine at position 8 of the amino acid sequence ITCPPPMSVEHADIWVKSYSLYSRERYICNS
- N-glycosylation on Ser 18 of amino acid sequence ITCPPPMSVEHADIWVKSYSLYSRERYICNS
- N- glycosylation on serine at position 20 of the amino acid sequence ITCPPPMSVEHADIWVKSYSLYSRERYICNS
- N- glycosylation on serine at position 23 of the amino acid sequence ITCPPPMSVEHADIWVKSYSLYSRERYICNS
- N-glycosylated on serine at position 31 of the amino acid sequence ITCPPPMSVEHADIWVKSYSLYSRERYICNS
